PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00007825-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 271aa    MW: 30316.4 Da    PI: 8.3913
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00007825-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-1682125146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ +++E++l+++++k+lG++ W++Ia +++ gRt++++k++w++
  PSME_00007825-RA  82 RGNISPDEEDLIIRLHKLLGNR-WSLIAGRIP-GRTDNEVKNYWNT 125
                       7899******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.8423676IPR017877Myb-like domain
SuperFamilySSF466892.79E-2140123IPR009057Homeodomain-like
SMARTSM007170.0144078IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-114283IPR009057Homeodomain-like
PROSITE profilePS5129423.83777131IPR017930Myb domain
SMARTSM007171.7E-1581129IPR001005SANT/Myb domain
PfamPF002491.2E-1482125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-2484130IPR009057Homeodomain-like
CDDcd001679.41E-1286127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MESVVVSQQL CYRLPISFFN NIKLEPGKGP ETFQVAGGID RGPWTQDEDL CLTQFIGAHG  60
LKRCGKSCRF RWVNYLRPSV KRGNISPDEE DLIIRLHKLL GNRWSLIAGR IPGRTDNEVK  120
NYWNTRLNKK GHATGCIRLK SIKPRKPNIS EPAVSLLTPT SANQEGEKEK VICCPVIEDL  180
KNGPTSSNYP MKQEASSSSD PGKLAAVSAE MDLWNSLQLN LNSIPSWTCS NFLHEDFKSD  240
FFPEPFGYNQ ENIRPGPLSA GEGEIVGRDR V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-23411307107B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGVIT_04s0008g01800.t011e-44(Vitis vinifera)
STRINGGLYMA13G16890.13e-44(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.13e-44myb domain protein 82